Lineage for d2akzb2 (2akz B:1001-1139)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 722893Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 722894Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 722895Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 722940Protein Enolase [54828] (7 species)
  7. 722984Species Human (Homo sapiens), gamma isoform [TaxId:9606] [110936] (3 PDB entries)
  8. 722986Domain d2akzb2: 2akz B:1001-1139 [126947]
    Other proteins in same PDB: d2akza1, d2akzb1
    automatically matched to d1te6a2
    complexed with f, mg, po4, trs

Details for d2akzb2

PDB Entry: 2akz (more details), 1.36 Å

PDB Description: fluoride inhibition of enolase: crystal structure of the inhibitory complex
PDB Compounds: (B:) Gamma enolase

SCOP Domain Sequences for d2akzb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2akzb2 d.54.1.1 (B:1001-1139) Enolase {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
siekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgkg
vlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavcka
gaaerelplyrhiaqlagn

SCOP Domain Coordinates for d2akzb2:

Click to download the PDB-style file with coordinates for d2akzb2.
(The format of our PDB-style files is described here.)

Timeline for d2akzb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2akzb1