SCOPe 2.08: Domain d2akzb1: 2akz B:1140-1432

Lineage for d2akzb1 (2akz B:1140-1432)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.1: Enolase [51605] (2 proteins)
   automatically mapped to Pfam PF00113

6. Protein Enolase [51606] (11 species)
   Fold of this protein slightly differs from common fold in topology

7. Species Human (Homo sapiens), gamma isoform [TaxId:9606] [110371] (15 PDB entries)
   Uniprot P09104

8. Domain d2akzb1: 2akz B:1140-1432 [126946]
   Other proteins in same PDB: d2akza2, d2akza3, d2akzb2
   automated match to d1te6a1
   complexed with f, mg, po4, trs

Details for d2akzb1

PDB Entry: 2akz, 1.36 Å

PDB Description: fluoride inhibition of enolase: crystal structure of the inhibitory complex

PDB Compounds: (B:) Gamma enolase

SCOPe Domain Sequences for d2akzb1:

Sequence; same for both SEQRES and ATOM records:

>d2akzb1 c.1.11.1 (B:1140-1432) Enolase {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
sdlilpvpafnvinggshagnklamqefmilpvgaesfrdamrlgaevyhtlkgvikdky
gkdatnvgdeggfapnilensealelvkeaidkagytekivigmdvaasefyrdgkydld
fksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqddwaawskftanvgiqivgddl
tvtnpkrieraveekacnclllkvnqigsvteaiqacklaqengwgvmvshrsgetedtf
iadlvvglctgqiktgapcrserlakynqlmrieeelgdearfaghnfrnpsv

Timeline for d2akzb1:

• d2akzb1 first appeared in SCOP 1.73
  
• d2akzb1 appears in SCOPe 2.07