SCOPe 2.08: Domain d2akza2: 2akz A:1-139

Lineage for d2akza2 (2akz A:1-139)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
   C-terminal domain is beta/alpha-barrel

6. Protein Enolase [54828] (10 species)

7. Species Human (Homo sapiens), gamma isoform [TaxId:9606] [110936] (15 PDB entries)
   Uniprot P09104

8. Domain d2akza2: 2akz A:1-139 [126945]
   Other proteins in same PDB: d2akza1, d2akza3, d2akzb1
   automated match to d1te6a2
   complexed with f, mg, po4, trs

Details for d2akza2

PDB Entry: 2akz, 1.36 Å

PDB Description: fluoride inhibition of enolase: crystal structure of the inhibitory complex

PDB Compounds: (A:) Gamma enolase

SCOPe Domain Sequences for d2akza2:

Sequence; same for both SEQRES and ATOM records:

>d2akza2 d.54.1.1 (A:1-139) Enolase {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
siekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgkg
vlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavcka
gaaerelplyrhiaqlagn

Timeline for d2akza2:

• d2akza2 first appeared in SCOP 1.73
  
• d2akza2 appears in SCOPe 2.07