| Class b: All beta proteins [48724] (174 folds) |
| Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (9 families) ![]() bind hydrophobic ligands in their interior |
| Family b.60.1.1: Retinol binding protein-like [50815] (21 proteins) barrel, closed; n=8, S=12, meander |
| Protein beta-Lactoglobulin [50827] (3 species) |
| Species Cow (Bos taurus) [TaxId:9913] [50828] (21 PDB entries) Uniprot P02754 |
| Domain d2akqd1: 2akq D:5-160 [126930] automatically matched to d1bsoa_ |
PDB Entry: 2akq (more details), 3 Å
SCOP Domain Sequences for d2akqd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2akqd1 b.60.1.1 (D:5-160) beta-Lactoglobulin {Cow (Bos taurus) [TaxId: 9913]}
qtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqkwend
ecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslvcqclvr
tpevddealekfdkalkalpmhirlsfnptqleeqc
Timeline for d2akqd1: