Lineage for d2akqd_ (2akq D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2804248Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2804271Protein beta-Lactoglobulin [50827] (4 species)
  7. 2804272Species Cow (Bos taurus) [TaxId:9913] [50828] (76 PDB entries)
    Uniprot P02754
  8. 2804354Domain d2akqd_: 2akq D: [126930]
    automated match to d4ib6a_

Details for d2akqd_

PDB Entry: 2akq (more details), 3 Å

PDB Description: The structure of bovine B-lactoglobulin A in crystals grown at very low ionic strength
PDB Compounds: (D:) Beta-lactoglobulin variant A

SCOPe Domain Sequences for d2akqd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2akqd_ b.60.1.1 (D:) beta-Lactoglobulin {Cow (Bos taurus) [TaxId: 9913]}
qtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqkwend
ecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslvcqclvr
tpevddealekfdkalkalpmhirlsfnptqleeqc

SCOPe Domain Coordinates for d2akqd_:

Click to download the PDB-style file with coordinates for d2akqd_.
(The format of our PDB-style files is described here.)

Timeline for d2akqd_: