SCOP 1.73: Domain d2akqd1: 2akq D:5-160

Lineage for d2akqd1 (2akq D:5-160)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (8 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (20 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein beta-Lactoglobulin [50827] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50828] (16 PDB entries)

8. Domain d2akqd1: 2akq D:5-160 [126930]
   automatically matched to d1bsoa_

Details for d2akqd1

PDB Entry: 2akq, 3 Å

PDB Description: The structure of bovine B-lactoglobulin A in crystals grown at very low ionic strength

PDB Compounds: (D:) Beta-lactoglobulin variant A

SCOP Domain Sequences for d2akqd1:

Sequence; same for both SEQRES and ATOM records:

>d2akqd1 b.60.1.1 (D:5-160) beta-Lactoglobulin {Cow (Bos taurus) [TaxId: 9913]}
qtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqkwend
ecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslvcqclvr
tpevddealekfdkalkalpmhirlsfnptqleeqc

Timeline for d2akqd1:

• d2akqd1 is new in SCOP 1.73
  
• d2akqd1 appears in SCOP 1.75
  
• d2akqd1 appears in the current release, SCOPe 2.08, called d2akqd_