Lineage for d1bsoa_ (1bso A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 805867Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 805868Superfamily b.60.1: Lipocalins [50814] (9 families) (S)
    bind hydrophobic ligands in their interior
  5. 805869Family b.60.1.1: Retinol binding protein-like [50815] (21 proteins)
    barrel, closed; n=8, S=12, meander
  6. 805892Protein beta-Lactoglobulin [50827] (3 species)
  7. 805893Species Cow (Bos taurus) [TaxId:9913] [50828] (21 PDB entries)
    Uniprot P02754
  8. 805900Domain d1bsoa_: 1bso A: [27122]
    complexed with brc; mutant

Details for d1bsoa_

PDB Entry: 1bso (more details), 2.23 Å

PDB Description: 12-bromododecanoic acid binds inside the calyx of bovine beta-lactoglobulin
PDB Compounds: (A:) protein (bovine beta-lactoglobulin a)

SCOP Domain Sequences for d1bsoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bsoa_ b.60.1.1 (A:) beta-Lactoglobulin {Cow (Bos taurus) [TaxId: 9913]}
livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
wendecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslvcq
clvrtpevddealekfdkalkalpmhirlsfnptqleeqchi

SCOP Domain Coordinates for d1bsoa_:

Click to download the PDB-style file with coordinates for d1bsoa_.
(The format of our PDB-style files is described here.)

Timeline for d1bsoa_: