![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
![]() | Family c.1.11.1: Enolase [51605] (2 proteins) automatically mapped to Pfam PF00113 |
![]() | Protein Enolase [51606] (11 species) Fold of this protein slightly differs from common fold in topology |
![]() | Species Human (Homo sapiens), gamma isoform [TaxId:9606] [110371] (15 PDB entries) Uniprot P09104 |
![]() | Domain d2akmb1: 2akm B:140-432 [126921] Other proteins in same PDB: d2akma2, d2akmb2 automated match to d1te6a1 complexed with mg, po4, trs |
PDB Entry: 2akm (more details), 1.92 Å
SCOPe Domain Sequences for d2akmb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2akmb1 c.1.11.1 (B:140-432) Enolase {Human (Homo sapiens), gamma isoform [TaxId: 9606]} sdlilpvpafnvinggshagnklamqefmilpvgaesfrdamrlgaevyhtlkgvikdky gkdatnvgdeggfapnilensealelvkeaidkagytekivigmdvaasefyrdgkydld fksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqddwaawskftanvgiqivgddl tvtnpkrieraveekacnclllkvnqigsvteaiqacklaqengwgvmvshrsgetedtf iadlvvglctgqiktgapcrserlakynqlmrieeelgdearfaghnfrnpsv
Timeline for d2akmb1: