PDB entry 2akm

View 2akm on RCSB PDB site
Description: Fluoride Inhibition of Enolase: Crystal Structure of the Inhibitory Complex
Class: lyase
Keywords: enolase; fluoride inhibition; negative cooperativity; glycolysis; crystal structure; isothermal titration calorimetry, LYASE
Deposited on 2005-08-03, released 2006-03-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.211
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gamma enolase
    Species: Homo sapiens [TaxId:9606]
    Gene: ENO2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2akma1, d2akma2
  • Chain 'B':
    Compound: Gamma enolase
    Species: Homo sapiens [TaxId:9606]
    Gene: ENO2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2akmb1, d2akmb2
  • Heterogens: MG, PO4, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2akmA (A:)
    siekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgkg
    vlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavcka
    gaaerelplyrhiaqlagnsdlilpvpafnvinggshagnklamqefmilpvgaesfrda
    mrlgaevyhtlkgvikdkygkdatnvgdeggfapnilensealelvkeaidkagytekiv
    igmdvaasefyrdgkydldfksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqddw
    aawskftanvgiqivgddltvtnpkrieraveekacnclllkvnqigsvteaiqacklaq
    engwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqlmrieeelgdea
    rfaghnfrnpsvlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2akmA (A:)
    siekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgkg
    vlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavcka
    gaaerelplyrhiaqlagnsdlilpvpafnvinggshagnklamqefmilpvgaesfrda
    mrlgaevyhtlkgvikdkygkdatnvgdeggfapnilensealelvkeaidkagytekiv
    igmdvaasefyrdgkydldfksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqddw
    aawskftanvgiqivgddltvtnpkrieraveekacnclllkvnqigsvteaiqacklaq
    engwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqlmrieeelgdea
    rfaghnfrnpsvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2akmB (B:)
    siekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgkg
    vlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavcka
    gaaerelplyrhiaqlagnsdlilpvpafnvinggshagnklamqefmilpvgaesfrda
    mrlgaevyhtlkgvikdkygkdatnvgdeggfapnilensealelvkeaidkagytekiv
    igmdvaasefyrdgkydldfksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqddw
    aawskftanvgiqivgddltvtnpkrieraveekacnclllkvnqigsvteaiqacklaq
    engwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqlmrieeelgdea
    rfaghnfrnpsvlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2akmB (B:)
    siekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgkg
    vlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavcka
    gaaerelplyrhiaqlagnsdlilpvpafnvinggshagnklamqefmilpvgaesfrda
    mrlgaevyhtlkgvikdkygkdatnvgdeggfapnilensealelvkeaidkagytekiv
    igmdvaasefyrdgkydldfksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqddw
    aawskftanvgiqivgddltvtnpkrieraveekacnclllkvnqigsvteaiqacklaq
    engwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqlmrieeelgdea
    rfaghnfrnpsv