| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
| Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins) C-terminal domain is beta/alpha-barrel |
| Protein Enolase [54828] (10 species) |
| Species Human (Homo sapiens), gamma isoform [TaxId:9606] [110936] (15 PDB entries) Uniprot P09104 |
| Domain d2akmb2: 2akm B:1-139 [126922] Other proteins in same PDB: d2akma1, d2akmb1 automated match to d1te6a2 complexed with mg, po4, trs |
PDB Entry: 2akm (more details), 1.92 Å
SCOPe Domain Sequences for d2akmb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2akmb2 d.54.1.1 (B:1-139) Enolase {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
siekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgkg
vlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavcka
gaaerelplyrhiaqlagn
Timeline for d2akmb2: