![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily) core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) ![]() |
![]() | Family c.124.1.2: CoA transferase alpha subunit-like [74656] (7 proteins) parallel beta-sheet of 7 strands, order 4321567 |
![]() | Protein Putative enzyme YdiF N-terminal domain [142198] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [142199] (3 PDB entries) Uniprot P37766 4-276 |
![]() | Domain d2ahvb2: 2ahv B:4-276 [126796] Other proteins in same PDB: d2ahva1, d2ahvb1, d2ahvc1, d2ahvd1 automated match to d2ahua2 complexed with coa |
PDB Entry: 2ahv (more details), 2 Å
SCOPe Domain Sequences for d2ahvb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ahvb2 c.124.1.2 (B:4-276) Putative enzyme YdiF N-terminal domain {Escherichia coli [TaxId: 562]} vkppringrvpvlsaqeavnyipdeatlcvlgagggileattlitaladkykqtqtprnl siisptglgdradrgisplaqeglvkwalcghwgqsprisdlaeqnkiiaynypqgvltq tlraaaahqpgiisdigigtfvdprqqggklnevtkedliklvefdnkeylyykaiapdi afirattcdsegyatfedevmyldalviaqavhnnggivmmqvqkmvkkatlhpksvrip gylvdivvvdpdqsqlyggapvnrfisgdftld
Timeline for d2ahvb2: