Lineage for d2ahua2 (2ahu A:4-276)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) 
Family c.124.1.2: CoA transferase alpha subunit-like [74656] (7 proteins)
parallel beta-sheet of 7 strands, order 4321567
Protein Putative enzyme YdiF N-terminal domain [142198] (1 species) Species Escherichia coli [TaxId:562] [142199] (3 PDB entries)
Uniprot P37766 4-276
Domain d2ahua2: 2ahu A:4-276 [126786]
Other proteins in same PDB: d2ahua1, d2ahub1, d2ahuc1, d2ahud1
Details for d2ahua2
PDB Entry: 2ahu (more details), 1.9 Å
PDB Description: Crystal structure of Acyl-CoA transferase (YdiF) apoenzyme from Escherichia coli O157:H7.
PDB Compounds: (A:) putative enzyme YdiFSCOPe Domain Sequences for d2ahua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ahua2 c.124.1.2 (A:4-276) Putative enzyme YdiF N-terminal domain {Escherichia coli [TaxId: 562]}
vkppringrvpvlsaqeavnyipdeatlcvlgagggileattlitaladkykqtqtprnl
siisptglgdradrgisplaqeglvkwalcghwgqsprisdlaeqnkiiaynypqgvltq
tlraaaahqpgiisdigigtfvdprqqggklnevtkedliklvefdnkeylyykaiapdi
afirattcdsegyatfedevmyldalviaqavhnnggivmmqvqkmvkkatlhpksvrip
gylvdivvvdpdqsqlyggapvnrfisgdftld
SCOPe Domain Coordinates for d2ahua2:
Click to download the PDB-style file with coordinates for d2ahua2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2ahua2:
- d2ahua2 first appeared in SCOP 1.73
- d2ahua2 appears in SCOPe 2.07
View in 3D
