Lineage for d2ahrc2 (2ahr C:1-152)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 685975Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 685976Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 688157Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (17 proteins)
    the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
    C-terminal domains also show some similarity
  6. 688272Protein Pyrroline-5-carboxylate reductase ProC [117434] (2 species)
  7. 688275Species Streptococcus pyogenes [TaxId:1314] [141928] (2 PDB entries)
  8. 688283Domain d2ahrc2: 2ahr C:1-152 [126780]
    Other proteins in same PDB: d2ahra1, d2ahrb1, d2ahrc1, d2ahrd1, d2ahre1
    automatically matched to 2AHR A:1-152
    complexed with fmt, na, nap

Details for d2ahrc2

PDB Entry: 2ahr (more details), 2.15 Å

PDB Description: crystal structures of 1-pyrroline-5-carboxylate reductase from human pathogen streptococcus pyogenes
PDB Compounds: (C:) putative pyrroline carboxylate reductase

SCOP Domain Sequences for d2ahrc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ahrc2 c.2.1.6 (C:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]}
mkigiigvgkmasaiikglkqtpheliisgsslerskeiaeqlalpyamshqdlidqvdl
vilgikpqlfetvlkplhfkqpiismaagislqrlatfvgqdlpllrimpnmnaqilqss
taltgnalvsqelqarvrdltdsfgstfdise

SCOP Domain Coordinates for d2ahrc2:

Click to download the PDB-style file with coordinates for d2ahrc2.
(The format of our PDB-style files is described here.)

Timeline for d2ahrc2: