Lineage for d2ahrb1 (2ahr B:153-256)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 645590Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 645591Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (12 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 645735Family a.100.1.10: Pyrroline-5-carboxylate reductase ProC [116984] (1 protein)
    similar dimer to the class I KARI
  6. 645736Protein Pyrroline-5-carboxylate reductase ProC [116985] (2 species)
  7. 645739Species Streptococcus pyogenes [TaxId:1314] [140776] (2 PDB entries)
  8. 645746Domain d2ahrb1: 2ahr B:153-256 [126777]
    Other proteins in same PDB: d2ahra2, d2ahrb2, d2ahrc2, d2ahrd2, d2ahre2
    automatically matched to 2AHR A:153-256
    complexed with fmt, na, nap

Details for d2ahrb1

PDB Entry: 2ahr (more details), 2.15 Å

PDB Description: crystal structures of 1-pyrroline-5-carboxylate reductase from human pathogen streptococcus pyogenes
PDB Compounds: (B:) putative pyrroline carboxylate reductase

SCOP Domain Sequences for d2ahrb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ahrb1 a.100.1.10 (B:153-256) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]}
kdfdtftalagsspayiylfiealakagvkngipkakaleivtqtvlasasnlktssqsp
hdfidaicspggttiaglmelerlgltatvssaidktidkaksl

SCOP Domain Coordinates for d2ahrb1:

Click to download the PDB-style file with coordinates for d2ahrb1.
(The format of our PDB-style files is described here.)

Timeline for d2ahrb1: