SCOP 1.73: Domain d2ahrd1: 2ahr D:153-256

Lineage for d2ahrd1 (2ahr D:153-256)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (12 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.10: Pyrroline-5-carboxylate reductase ProC [116984] (1 protein)
   similar dimer to the class I KARI

6. Protein Pyrroline-5-carboxylate reductase ProC [116985] (2 species)

7. Species Streptococcus pyogenes [TaxId:1314] [140776] (2 PDB entries)

8. Domain d2ahrd1: 2ahr D:153-256 [126781]
   Other proteins in same PDB: d2ahra2, d2ahrb2, d2ahrc2, d2ahrd2, d2ahre2
   automatically matched to 2AHR A:153-256
   complexed with fmt, na, nap

Details for d2ahrd1

PDB Entry: 2ahr, 2.15 Å

PDB Description: crystal structures of 1-pyrroline-5-carboxylate reductase from human pathogen streptococcus pyogenes

PDB Compounds: (D:) putative pyrroline carboxylate reductase

SCOP Domain Sequences for d2ahrd1:

Sequence; same for both SEQRES and ATOM records:

>d2ahrd1 a.100.1.10 (D:153-256) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]}
kdfdtftalagsspayiylfiealakagvkngipkakaleivtqtvlasasnlktssqsp
hdfidaicspggttiaglmelerlgltatvssaidktidkaksl

Timeline for d2ahrd1:

• d2ahrd1 is new in SCOP 1.73
  
• d2ahrd1 appears in SCOP 1.75
  
• d2ahrd1 appears in the current release, SCOPe 2.08