![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.92: Chelatase-like [53799] (3 superfamilies) duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.92.2: 'Helical backbone' metal receptor [53807] (5 families) ![]() contains a long alpha helical insertion in the interdomain linker |
![]() | Family c.92.2.3: Nitrogenase iron-molybdenum protein [53816] (3 proteins) contains three domains of this fold; "Helical backbone" holds domains 2 and 3 both chains are homologous; the inter-chain arrangement of domains 1 is similar to the intra-chain arrangement of domains 2 and 3 automatically mapped to Pfam PF00148 |
![]() | Protein automated matches [190199] (4 species) not a true protein |
![]() | Species Azotobacter vinelandii [TaxId:354] [186943] (14 PDB entries) |
![]() | Domain d2afha_: 2afh A: [126679] Other proteins in same PDB: d2afhb_, d2afhd_, d2afhe_, d2afhf_ automated match to d1h1la_ complexed with 1pe, ca, cfn, clf, hca, na, p6g, peg, pg4, pge, sf4, trs |
PDB Entry: 2afh (more details), 2.1 Å
SCOPe Domain Sequences for d2afha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2afha_ c.92.2.3 (A:) automated matches {Azotobacter vinelandii [TaxId: 354]} sreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirgcay agskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqekdiv fggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpvrce gfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssrillee mglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffgptk tieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrprhvi gayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdligsg ikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe
Timeline for d2afha_: