Lineage for d2afha1 (2afh A:5-480)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 710253Fold c.92: Chelatase-like [53799] (2 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 710285Superfamily c.92.2: "Helical backbone" metal receptor [53807] (4 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 710318Family c.92.2.3: Nitrogenase iron-molybdenum protein [53816] (2 proteins)
    contains three domains of this fold; "Helical backbone" holds domains 2 and 3
    both chains are homologous; the inter-chain arrangement of domains 1 is similar to the intra-chain arrangement of domains 2 and 3
  6. 710319Protein Nitrogenase iron-molybdenum protein, alpha chain [81402] (3 species)
  7. 710320Species Azotobacter vinelandii [TaxId:354] [81398] (13 PDB entries)
  8. 710325Domain d2afha1: 2afh A:5-480 [126679]
    Other proteins in same PDB: d2afhb1, d2afhd1, d2afhe1, d2afhf1
    automatically matched to d1m34a_
    complexed with 1pe, ca, cfn, clf, hca, na, p6g, peg, pg4, pge, sf4, trs

Details for d2afha1

PDB Entry: 2afh (more details), 2.1 Å

PDB Description: crystal structure of nucleotide-free av2-av1 complex
PDB Compounds: (A:) Nitrogenase molybdenum-iron protein

SCOP Domain Sequences for d2afha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2afha1 c.92.2.3 (A:5-480) Nitrogenase iron-molybdenum protein, alpha chain {Azotobacter vinelandii [TaxId: 354]}
sreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirgcay
agskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqekdiv
fggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpvrce
gfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssrillee
mglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffgptk
tieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrprhvi
gayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdligsg
ikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe

SCOP Domain Coordinates for d2afha1:

Click to download the PDB-style file with coordinates for d2afha1.
(The format of our PDB-style files is described here.)

Timeline for d2afha1: