SCOPe 2.08: Domain d2afhc_: 2afh C:

Lineage for d2afhc_ (2afh C:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.92: Chelatase-like [53799] (3 superfamilies)
   duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.92.2: 'Helical backbone' metal receptor [53807] (5 families)
   contains a long alpha helical insertion in the interdomain linker

5. Family c.92.2.3: Nitrogenase iron-molybdenum protein [53816] (3 proteins)
   contains three domains of this fold; "Helical backbone" holds domains 2 and 3
   both chains are homologous; the inter-chain arrangement of domains 1 is similar to the intra-chain arrangement of domains 2 and 3
   automatically mapped to Pfam PF00148

6. Protein automated matches [190199] (4 species)
   not a true protein

7. Species Azotobacter vinelandii [TaxId:354] [186943] (14 PDB entries)

8. Domain d2afhc_: 2afh C: [126681]
   Other proteins in same PDB: d2afhb_, d2afhd_, d2afhe_, d2afhf_
   automated match to d1h1la_
   complexed with 1pe, ca, cfn, clf, hca, na, p6g, peg, pg4, pge, sf4, trs

Details for d2afhc_

PDB Entry: 2afh, 2.1 Å

PDB Description: crystal structure of nucleotide-free av2-av1 complex

PDB Compounds: (C:) Nitrogenase molybdenum-iron protein

SCOPe Domain Sequences for d2afhc_:

Sequence; same for both SEQRES and ATOM records:

>d2afhc_ c.92.2.3 (C:) automated matches {Azotobacter vinelandii [TaxId: 354]}
msreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirgca
yagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqekdi
vfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpvrc
egfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssrille
emglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffgpt
ktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrprhv
igayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdligs
gikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe

Timeline for d2afhc_:

• d2afhc_ first appeared in SCOP 1.73, called d2afhc1
  
• d2afhc_ appears in SCOPe 2.07