SCOPe 2.08: Domain d2aewb2: 2aew B:130-233

Lineage for d2aewb2 (2aew B:130-233)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein automated matches [190888] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188282] (33 PDB entries)

8. Domain d2aewb2: 2aew B:130-233 [126651]
   automated match to d2aewb2

Details for d2aewb2

PDB Entry: 2aew, 2.7 Å

PDB Description: a model for growth hormone receptor activation based on subunit rotation within a receptor dimer

PDB Compounds: (B:) growth hormone receptor

SCOPe Domain Sequences for d2aewb2:

Sequence; same for both SEQRES and ATOM records:

>d2aewb2 b.1.2.1 (B:130-233) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpdppialnwtllnvsltgihadiqvrweaprnadiqkgwmvleyelqykevnetkwkmm
dpilttsvpvyslkvdkeyevrvrskqrnsgnygefsevlyvtl

Timeline for d2aewb2:

• d2aewb2 first appeared in SCOP 1.73
  
• d2aewb2 appears in SCOPe 2.07