Lineage for d2aewa1 (2aew A:29-129)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2761682Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2762155Protein automated matches [190888] (2 species)
    not a true protein
  7. 2762158Species Human (Homo sapiens) [TaxId:9606] [188282] (33 PDB entries)
  8. 2762218Domain d2aewa1: 2aew A:29-129 [126648]
    automated match to d2aewa1

Details for d2aewa1

PDB Entry: 2aew (more details), 2.7 Å

PDB Description: a model for growth hormone receptor activation based on subunit rotation within a receptor dimer
PDB Compounds: (A:) growth hormone receptor

SCOPe Domain Sequences for d2aewa1:

Sequence, based on SEQRES records: (download)

>d2aewa1 b.1.2.1 (A:29-129) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sskepkftkcrsperetfschwtdevhhgtknlgpiqlfytrrntqewtqewkecpdyvs
agenscyfnssftsiwipycikltsnggtvdekcfsvdeiv

Sequence, based on observed residues (ATOM records): (download)

>d2aewa1 b.1.2.1 (A:29-129) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sskepkftkcrsperetfschwtdevnlgpiqlfytrrnqewkecpdyvsagenscyfns
sftsiwipycikltsnggtvdekcfsvdeiv

SCOPe Domain Coordinates for d2aewa1:

Click to download the PDB-style file with coordinates for d2aewa1.
(The format of our PDB-style files is described here.)

Timeline for d2aewa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2aewa2