PDB entry 2aew

View 2aew on RCSB PDB site
Description: A model for growth hormone receptor activation based on subunit rotation within a receptor dimer
Class: hormone/growth factor
Keywords: HORMONE/GROWTH FACTOR, HORMONE-GROWTH FACTOR complex
Deposited on 2005-07-24, released 2005-11-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: growth hormone receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2aewa1, d2aewa2
  • Chain 'B':
    Compound: growth hormone receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2aewb1, d2aewb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2aewA (A:)
    sskepkftkcrsperetfschwtdevhhgtknlgpiqlfytrrntqewtqewkecpdyvs
    agenscyfnssftsiwipycikltsnggtvdekcfsvdeivqpdppialnwtllnvsltg
    ihadiqvrweaprnadiqkgwmvleyelqykevnetkwkmmdpilttsvpvyslkvdkey
    evrvrskqrnsgnygefsevlyvtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aewA (A:)
    sskepkftkcrsperetfschwtdevnlgpiqlfytrrnqewkecpdyvsagenscyfns
    sftsiwipycikltsnggtvdekcfsvdeivqpdppialnwtllnvsltgihadiqvrwe
    aprnamvleyelqykevnetkwkmmdpilttsvpvyslkvdkeyevrvrskqrnsgnyge
    fsevlyvtl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2aewB (B:)
    sskepkftkcrsperetfschwtdevhhgtknlgpiqlfytrrntqewtqewkecpdyvs
    agenscyfnssftsiwipycikltsnggtvdekcfsvdeivqpdppialnwtllnvsltg
    ihadiqvrweaprnadiqkgwmvleyelqykevnetkwkmmdpilttsvpvyslkvdkey
    evrvrskqrnsgnygefsevlyvtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aewB (B:)
    kepkftkcrsperetfschwtdgpiqlfytrrqewkecpdyvsagenscyfnssftsiwi
    pycikltsnggtvdekcfsvdeivqpdppialnwtllnvsltgihadiqvrweaprnadi
    qkgwmvleyelqykevnetkwkmmdpilttsvpvyslkvdkeyevrvrskqrnsgnygef
    sevlyvtl