Lineage for d2aeit1 (2aei T:6-108)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2761682Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2761786Protein Extracellular region of human tissue factor [49267] (2 species)
    tandem of fibronectin type III domains
  7. 2761787Species Human (Homo sapiens) [TaxId:9606] [49268] (35 PDB entries)
    Uniprot P13726 33-242
  8. 2761823Domain d2aeit1: 2aei T:6-108 [126635]
    Other proteins in same PDB: d2aeih_, d2aeil1, d2aeil2, d2aeil3
    automatically matched to d1a21a1
    complexed with 03r, ca, cac

Details for d2aeit1

PDB Entry: 2aei (more details), 2.52 Å

PDB Description: Crystal structure of a ternary complex of factor VIIa/tissue factor and 2-[[6-[3-(aminoiminomethyl)phenoxy]-3,5-difluro-4-[(1-methyl-3-phenylpropyl)amino]-2-pyridinyl]oxy]-benzoic acid
PDB Compounds: (T:) tissue factor

SCOPe Domain Sequences for d2aeit1:

Sequence, based on SEQRES records: (download)

>d2aeit1 b.1.2.1 (T:6-108) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk
dvkqtylarvfsypagnvestgsageplyenspeftpyletnl

Sequence, based on observed residues (ATOM records): (download)

>d2aeit1 b.1.2.1 (T:6-108) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk
dvkqtylarvfsypageplyenspeftpyletnl

SCOPe Domain Coordinates for d2aeit1:

Click to download the PDB-style file with coordinates for d2aeit1.
(The format of our PDB-style files is described here.)

Timeline for d2aeit1: