Lineage for d2aeil1 (2aei L:49-86)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3031137Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 3031138Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 3031147Protein Coagulation factor VIIa [57201] (1 species)
  7. 3031148Species Human (Homo sapiens) [TaxId:9606] [57202] (97 PDB entries)
    Uniprot P08709 108-202 ! Uniprot P08709 107-202
  8. 3031230Domain d2aeil1: 2aei L:49-86 [126632]
    Other proteins in same PDB: d2aeih_, d2aeil3, d2aeit1, d2aeit2
    automated match to d1danl1
    complexed with 03r, ca, cac

Details for d2aeil1

PDB Entry: 2aei (more details), 2.52 Å

PDB Description: Crystal structure of a ternary complex of factor VIIa/tissue factor and 2-[[6-[3-(aminoiminomethyl)phenoxy]-3,5-difluro-4-[(1-methyl-3-phenylpropyl)amino]-2-pyridinyl]oxy]-benzoic acid
PDB Compounds: (L:) Coagulation factor VII

SCOPe Domain Sequences for d2aeil1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aeil1 g.3.11.1 (L:49-86) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
qcasspcqnggsckdqlqsyicfclpafegrncethkd

SCOPe Domain Coordinates for d2aeil1:

Click to download the PDB-style file with coordinates for d2aeil1.
(The format of our PDB-style files is described here.)

Timeline for d2aeil1: