Class a: All alpha proteins [46456] (290 folds) |
Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily a.137.2: Methanol dehydrogenase subunit [48666] (1 family) consists of single alpha-helix and irregular N-terminal tail automatically mapped to Pfam PF02315 |
Family a.137.2.1: Methanol dehydrogenase subunit [48667] (2 proteins) |
Protein Methanol dehydrogenase, light chain [48668] (3 species) |
Species Methylophilus methylotrophus, w3a1 [TaxId:17] [48669] (6 PDB entries) |
Domain d2ad6b_: 2ad6 B: [126569] Other proteins in same PDB: d2ad6a_, d2ad6c_ automated match to d4aahb_ complexed with ca, pqq |
PDB Entry: 2ad6 (more details), 1.5 Å
SCOPe Domain Sequences for d2ad6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ad6b_ a.137.2.1 (B:) Methanol dehydrogenase, light chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} ydgqnckepgncwenkpgypekiagskydpkhdpvelnkqeesikamdarnakrianaks sgnfvfdvk
Timeline for d2ad6b_: