SCOPe 2.08: Domain d2ad6d_: 2ad6 D:

Lineage for d2ad6d_ (2ad6 D:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.137.2: Methanol dehydrogenase subunit [48666] (1 family)
   consists of single alpha-helix and irregular N-terminal tail
   automatically mapped to Pfam PF02315

5. Family a.137.2.1: Methanol dehydrogenase subunit [48667] (2 proteins)

6. Protein Methanol dehydrogenase, light chain [48668] (3 species)

7. Species Methylophilus methylotrophus, w3a1 [TaxId:17] [48669] (6 PDB entries)

8. Domain d2ad6d_: 2ad6 D: [126571]
   Other proteins in same PDB: d2ad6a_, d2ad6c_
   automated match to d4aahb_
   complexed with ca, pqq

Details for d2ad6d_

PDB Entry: 2ad6, 1.5 Å

PDB Description: crystal structure of methanol dehydrogenase from M. W3A1 (form C)

PDB Compounds: (D:) methanol dehydrogenase subunit 2

SCOPe Domain Sequences for d2ad6d_:

Sequence; same for both SEQRES and ATOM records:

>d2ad6d_ a.137.2.1 (D:) Methanol dehydrogenase, light chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]}
ydgqnckepgncwenkpgypekiagskydpkhdpvelnkqeesikamdarnakrianaks
sgnfvfdvk

Timeline for d2ad6d_:

• d2ad6d_ first appeared in SCOP 1.73, called d2ad6d1
  
• d2ad6d_ appears in SCOPe 2.07