Lineage for d2ad6b1 (2ad6 B:1-69)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 649538Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (12 superfamilies)
    not a true fold
  4. 649562Superfamily a.137.2: Methanol dehydrogenase subunit [48666] (1 family) (S)
    consists of single alpha-helix and irregular N-terminal tail
  5. 649563Family a.137.2.1: Methanol dehydrogenase subunit [48667] (1 protein)
  6. 649564Protein Methanol dehydrogenase, light chain [48668] (3 species)
  7. 649574Species Methylophilus methylotrophus, w3a1 [TaxId:17] [48669] (5 PDB entries)
  8. 649575Domain d2ad6b1: 2ad6 B:1-69 [126569]
    Other proteins in same PDB: d2ad6a1, d2ad6c1
    automatically matched to d4aahb_
    complexed with ca, pqq

Details for d2ad6b1

PDB Entry: 2ad6 (more details), 1.5 Å

PDB Description: crystal structure of methanol dehydrogenase from M. W3A1 (form C)
PDB Compounds: (B:) methanol dehydrogenase subunit 2

SCOP Domain Sequences for d2ad6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ad6b1 a.137.2.1 (B:1-69) Methanol dehydrogenase, light chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]}
ydgqnckepgncwenkpgypekiagskydpkhdpvelnkqeesikamdarnakrianaks
sgnfvfdvk

SCOP Domain Coordinates for d2ad6b1:

Click to download the PDB-style file with coordinates for d2ad6b1.
(The format of our PDB-style files is described here.)

Timeline for d2ad6b1: