![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (12 superfamilies) not a true fold |
![]() | Superfamily a.137.2: Methanol dehydrogenase subunit [48666] (1 family) ![]() consists of single alpha-helix and irregular N-terminal tail |
![]() | Family a.137.2.1: Methanol dehydrogenase subunit [48667] (1 protein) |
![]() | Protein Methanol dehydrogenase, light chain [48668] (3 species) |
![]() | Species Methylophilus methylotrophus, w3a1 [TaxId:17] [48669] (5 PDB entries) |
![]() | Domain d2ad6b1: 2ad6 B:1-69 [126569] Other proteins in same PDB: d2ad6a1, d2ad6c1 automatically matched to d4aahb_ complexed with ca, pqq |
PDB Entry: 2ad6 (more details), 1.5 Å
SCOP Domain Sequences for d2ad6b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ad6b1 a.137.2.1 (B:1-69) Methanol dehydrogenase, light chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} ydgqnckepgncwenkpgypekiagskydpkhdpvelnkqeesikamdarnakrianaks sgnfvfdvk
Timeline for d2ad6b1: