SCOP 1.73: Domain d2ad6b1: 2ad6 B:1-69

Lineage for d2ad6b1 (2ad6 B:1-69)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (12 superfamilies)
   not a true fold

4. Superfamily a.137.2: Methanol dehydrogenase subunit [48666] (1 family)
   consists of single alpha-helix and irregular N-terminal tail

5. Family a.137.2.1: Methanol dehydrogenase subunit [48667] (1 protein)

6. Protein Methanol dehydrogenase, light chain [48668] (3 species)

7. Species Methylophilus methylotrophus, w3a1 [TaxId:17] [48669] (5 PDB entries)

8. Domain d2ad6b1: 2ad6 B:1-69 [126569]
   Other proteins in same PDB: d2ad6a1, d2ad6c1
   automatically matched to d4aahb_
   complexed with ca, pqq

Details for d2ad6b1

PDB Entry: 2ad6, 1.5 Å

PDB Description: crystal structure of methanol dehydrogenase from M. W3A1 (form C)

PDB Compounds: (B:) methanol dehydrogenase subunit 2

SCOP Domain Sequences for d2ad6b1:

Sequence; same for both SEQRES and ATOM records:

>d2ad6b1 a.137.2.1 (B:1-69) Methanol dehydrogenase, light chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]}
ydgqnckepgncwenkpgypekiagskydpkhdpvelnkqeesikamdarnakrianaks
sgnfvfdvk

Timeline for d2ad6b1:

• d2ad6b1 is new in SCOP 1.73
  
• d2ad6b1 appears in SCOP 1.75
  
• d2ad6b1 appears in the current release, SCOPe 2.07, called d2ad6b_