Lineage for d2abrd_ (2abr D:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537906Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 2537907Superfamily d.126.1: Pentein [55909] (8 families) (S)
  5. 2537944Family d.126.1.4: Arginine deiminase [103232] (1 protein)
    functionally related to the amidinotransferase, similar active sites
  6. 2537945Protein Arginine deiminase [103233] (2 species)
  7. 2537951Species Pseudomonas aeruginosa [TaxId:287] [103234] (5 PDB entries)
  8. 2537971Domain d2abrd_: 2abr D: [126533]
    automated match to d1rxxb_

Details for d2abrd_

PDB Entry: 2abr (more details), 2.9 Å

PDB Description: Structure of D280A arginine deiminase with L-arginine forming a S-alkylthiouronium reaction intermediate
PDB Compounds: (D:) Arginine deiminase

SCOPe Domain Sequences for d2abrd_:

Sequence, based on SEQRES records: (download)

>d2abrd_ d.126.1.4 (D:) Arginine deiminase {Pseudomonas aeruginosa [TaxId: 287]}
tklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfdfvtkmrer
gidvlemhnlltetiqnpealkwildrkitadsvglgltselrswlesleprklaeylig
gvaaddlpaseganilkmyreylghssfllpplpntqftrdttcwiyggvtlnpmywpar
rqetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvligmgerss
rqaigqvaqslfakgaaervivaglpksraamhlatvfsfcdrdlvtvfpevvkeivpfs
lrpdpsspygmnirreektflevvaeslglkklrvvetggnsfaaereqwddgnnvvcle
pgvvvgydrntytntllrkagvevitisaselgrgrggghcmtcpivrdpi

Sequence, based on observed residues (ATOM records): (download)

>d2abrd_ d.126.1.4 (D:) Arginine deiminase {Pseudomonas aeruginosa [TaxId: 287]}
tklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfdfvtkmrer
gidvlemhnlltetiqnpealkwildrkitadsvglgltselrswlesleprklaeylig
gvaaddlpaseganilkmyreylghssfllpplpntqftrdttcwiyggvtlnpmywpar
rqetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvligmgerss
rqaigqvaqslfakgaaervivaglpksrmhlatvfsfcdrdlvtvfpevvkeivpfslr
pdpsspygmnirreektflevvaeslglkklrvvetgreqwddgnnvvclepgvvvgydr
ntytntllrkagvevitisaselgrgrggghcmtcpivrdpi

SCOPe Domain Coordinates for d2abrd_:

Click to download the PDB-style file with coordinates for d2abrd_.
(The format of our PDB-style files is described here.)

Timeline for d2abrd_: