Lineage for d2aawc2 (2aaw C:1-85)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1168056Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1168057Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1168419Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)
  6. 1168932Protein Pf GST [102442] (1 species)
    cannot be assigned to any of the known GST classes
  7. 1168933Species Malarial parasite (Plasmodium falciparum) [TaxId:5833] [102443] (4 PDB entries)
  8. 1168939Domain d2aawc2: 2aaw C:1-85 [126499]
    Other proteins in same PDB: d2aawa1, d2aawc1
    automatically matched to d1okta2
    complexed with dtl, gtx, p33

Details for d2aawc2

PDB Entry: 2aaw (more details), 2.4 Å

PDB Description: studies on ligand binding and enzyme inhibition of plasmodium falciparum glutathione s-transferase
PDB Compounds: (C:) glutathione s-transferase

SCOPe Domain Sequences for d2aawc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aawc2 c.47.1.5 (C:1-85) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]}
mgdnivlyyfdargkaelirlifaylgieytdkrfgvngdafvefknfkkekdtpfeqvp
ilqigdlilaqsqaivrylskkyni

SCOPe Domain Coordinates for d2aawc2:

Click to download the PDB-style file with coordinates for d2aawc2.
(The format of our PDB-style files is described here.)

Timeline for d2aawc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2aawc1