| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins) |
| Protein Pf GST [102442] (1 species) cannot be assigned to any of the known GST classes |
| Species Malarial parasite (Plasmodium falciparum) [TaxId:5833] [102443] (4 PDB entries) |
| Domain d2aawc2: 2aaw C:1-85 [126499] Other proteins in same PDB: d2aawa1, d2aawc1 automatically matched to d1okta2 complexed with dtl, gtx, p33 |
PDB Entry: 2aaw (more details), 2.4 Å
SCOPe Domain Sequences for d2aawc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aawc2 c.47.1.5 (C:1-85) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]}
mgdnivlyyfdargkaelirlifaylgieytdkrfgvngdafvefknfkkekdtpfeqvp
ilqigdlilaqsqaivrylskkyni
Timeline for d2aawc2: