Lineage for d2aawa1 (2aaw A:86-211)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1089232Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1089233Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1089234Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)
  6. 1089747Protein Pf GST [101210] (1 species)
    cannot be assigned to any of the known GST classes
  7. 1089748Species Malarial parasite (Plasmodium falciparum) [TaxId:5833] [101211] (4 PDB entries)
  8. 1089753Domain d2aawa1: 2aaw A:86-211 [126496]
    Other proteins in same PDB: d2aawa2, d2aawc2
    automatically matched to d1okta1
    complexed with dtl, gtx, p33

Details for d2aawa1

PDB Entry: 2aaw (more details), 2.4 Å

PDB Description: studies on ligand binding and enzyme inhibition of plasmodium falciparum glutathione s-transferase
PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d2aawa1:

Sequence, based on SEQRES records: (download)

>d2aawa1 a.45.1.1 (A:86-211) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]}
cgeselnefyadmifcgvqdihykfnntnlfkqnettflnedlpkwsgyfekllkknhtn
nnndkyyfvgnnltyadlavfnlyddietkypsslknfpllkahnefisnlpniknyitn
rkesvy

Sequence, based on observed residues (ATOM records): (download)

>d2aawa1 a.45.1.1 (A:86-211) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]}
cgeselnefyadmifcgvqdihykfnntnlfkqnettflnedlpkwsgyfekllkknhky
yfvgnnltyadlavfnlyddietkypsslknfpllkahnefisnlpniknyitnrkesvy

SCOPe Domain Coordinates for d2aawa1:

Click to download the PDB-style file with coordinates for d2aawa1.
(The format of our PDB-style files is described here.)

Timeline for d2aawa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2aawa2