Lineage for d2aalf_ (2aal F:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2526467Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. 2526468Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) (S)
  5. 2526983Family d.80.1.6: MSAD-like [143532] (1 protein)
  6. 2526984Protein Malonate semialdehyde decarboxylase, MSAD [143533] (1 species)
  7. 2526985Species Pseudomonas pavonaceae [TaxId:47881] [143534] (3 PDB entries)
    Uniprot Q9EV83 2-130! Uniprot Q9EV83 2-230
  8. 2526991Domain d2aalf_: 2aal F: [126488]
    Other proteins in same PDB: d2aalb3
    automated match to d2aaga1
    mutant

Details for d2aalf_

PDB Entry: 2aal (more details), 1.65 Å

PDB Description: Crystal Structures of the Wild-type, Mutant-P1A and Inactivated Malonate Semialdehyde Decarboxylase: A Structural Basis for the Decarboxylase and Hydratase Activities
PDB Compounds: (F:) Malonate Semialdehyde Decarboxylase

SCOPe Domain Sequences for d2aalf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aalf_ d.80.1.6 (F:) Malonate semialdehyde decarboxylase, MSAD {Pseudomonas pavonaceae [TaxId: 47881]}
xpllkfdlfygrtdaqikslldaahgamvdafgvpandryqtvsqhrpgemvledtglgy
grssavvlltvisrprseeqkvcfyklltgalerdcgispddvivalvensdadwsfgrg
raefltgdlv

SCOPe Domain Coordinates for d2aalf_:

Click to download the PDB-style file with coordinates for d2aalf_.
(The format of our PDB-style files is described here.)

Timeline for d2aalf_: