SCOPe 2.08: Domain d2aalf_: 2aal F:

Lineage for d2aalf_ (2aal F:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
   (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
   generally forms trimers with three closely packed beta-sheets

4. Superfamily d.80.1: Tautomerase/MIF [55331] (7 families)

5. Family d.80.1.6: MSAD-like [143532] (1 protein)

6. Protein Malonate semialdehyde decarboxylase, MSAD [143533] (1 species)

7. Species Pseudomonas pavonaceae [TaxId:47881] [143534] (3 PDB entries)
   Uniprot Q9EV83 2-130! Uniprot Q9EV83 2-230

8. Domain d2aalf_: 2aal F: [126488]
   Other proteins in same PDB: d2aalb3
   automated match to d2aaga1
   mutant

Details for d2aalf_

PDB Entry: 2aal, 1.65 Å

PDB Description: crystal structures of the wild-type, mutant-p1a and inactivated malonate semialdehyde decarboxylase: a structural basis for the decarboxylase and hydratase activities

PDB Compounds: (F:) Malonate Semialdehyde Decarboxylase

SCOPe Domain Sequences for d2aalf_:

Sequence; same for both SEQRES and ATOM records:

>d2aalf_ d.80.1.6 (F:) Malonate semialdehyde decarboxylase, MSAD {Pseudomonas pavonaceae [TaxId: 47881]}
xpllkfdlfygrtdaqikslldaahgamvdafgvpandryqtvsqhrpgemvledtglgy
grssavvlltvisrprseeqkvcfyklltgalerdcgispddvivalvensdadwsfgrg
raefltgdlv

Timeline for d2aalf_:

• d2aalf_ first appeared in SCOP 1.73, called d2aalf1
  
• d2aalf_ appears in SCOPe 2.07