Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.80: Tautomerase/MIF [55330] (1 superfamily) (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet generally forms trimers with three closely packed beta-sheets |
Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) |
Family d.80.1.6: MSAD-like [143532] (1 protein) |
Protein Malonate semialdehyde decarboxylase, MSAD [143533] (1 species) |
Species Pseudomonas pavonaceae [TaxId:47881] [143534] (3 PDB entries) Uniprot Q9EV83 2-130! Uniprot Q9EV83 2-230 |
Domain d2aala1: 2aal A:1-129 [126483] Other proteins in same PDB: d2aalb3 mutant |
PDB Entry: 2aal (more details), 1.65 Å
SCOPe Domain Sequences for d2aala1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aala1 d.80.1.6 (A:1-129) Malonate semialdehyde decarboxylase, MSAD {Pseudomonas pavonaceae [TaxId: 47881]} pllkfdlfygrtdaqikslldaahgamvdafgvpandryqtvsqhrpgemvledtglgyg rssavvlltvisrprseeqkvcfyklltgalerdcgispddvivalvensdadwsfgrgr aefltgdlv
Timeline for d2aala1: