SCOP 1.73: Domain d2aala1: 2aal A:1-129

Lineage for d2aala1 (2aal A:1-129)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
   (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
   generally forms trimers with three closely packed beta-sheets

4. Superfamily d.80.1: Tautomerase/MIF [55331] (6 families)

5. Family d.80.1.6: MSAD-like [143532] (1 protein)

6. Protein Malonate semialdehyde decarboxylase, MSAD [143533] (1 species)

7. Species Pseudomonas pavonaceae [TaxId:47881] [143534] (3 PDB entries)

8. Domain d2aala1: 2aal A:1-129 [126483]
   complexed with mli; mutant

Details for d2aala1

PDB Entry: 2aal, 1.65 Å

PDB Description: crystal structures of the wild-type, mutant-p1a and inactivated malonate semialdehyde decarboxylase: a structural basis for the decarboxylase and hydratase activities

PDB Compounds: (A:) Malonate Semialdehyde Decarboxylase

SCOP Domain Sequences for d2aala1:

Sequence; same for both SEQRES and ATOM records:

>d2aala1 d.80.1.6 (A:1-129) Malonate semialdehyde decarboxylase, MSAD {Pseudomonas pavonaceae [TaxId: 47881]}
pllkfdlfygrtdaqikslldaahgamvdafgvpandryqtvsqhrpgemvledtglgyg
rssavvlltvisrprseeqkvcfyklltgalerdcgispddvivalvensdadwsfgrgr
aefltgdlv

Timeline for d2aala1:

• d2aala1 is new in SCOP 1.73
  
• d2aala1 appears in SCOP 1.75
  
• d2aala1 appears in the current release, SCOPe 2.08