Lineage for d2aale_ (2aal E:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) (S)
  5. Family d.80.1.6: MSAD-like [143532] (1 protein)
  6. Protein Malonate semialdehyde decarboxylase, MSAD [143533] (1 species)
  7. Species Pseudomonas pavonaceae [TaxId:47881] [143534] (3 PDB entries)
    Uniprot Q9EV83 2-130! Uniprot Q9EV83 2-230
  8. Domain d2aale_: 2aal E: [126487]
    Other proteins in same PDB: d2aalb3
    automated match to d2aaga1
    mutant

Details for d2aale_

PDB Entry: 2aal (more details), 1.65 Å

PDB Description: Crystal Structures of the Wild-type, Mutant-P1A and Inactivated Malonate Semialdehyde Decarboxylase: A Structural Basis for the Decarboxylase and Hydratase Activities
PDB Compounds: (E:) Malonate Semialdehyde Decarboxylase

SCOPe Domain Sequences for d2aale_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aale_ d.80.1.6 (E:) Malonate semialdehyde decarboxylase, MSAD {Pseudomonas pavonaceae [TaxId: 47881]}
xpllkfdlfygrtdaqikslldaahgamvdafgvpandryqtvsqhrpgemvledtglgy
grssavvlltvisrprseeqkvcfyklltgalerdcgispddvivalvensdadwsfgrg
raefltgdlv

SCOPe Domain Coordinates for d2aale_ are not available.

Timeline for d2aale_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2aala1, d2aalb2, d2aalb3, d2aalc_, d2aald_, d2aalf_