SCOP 1.73: Domain d2a7sd1: 2a7s D:20-277

Lineage for d2a7sd1 (2a7s D:20-277)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (4 families)

5. Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (6 proteins)
   Pfam PF01039
   the active site is formed by two different homologous subunits or domains of this fold

6. Protein Propionyl-CoA carboxylase complex B subunit, PccB [117466] (3 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [142010] (1 PDB entry)

8. Domain d2a7sd1: 2a7s D:20-277 [126359]
   automatically matched to 2A7S A:20-277

Details for d2a7sd1

PDB Entry: 2a7s, 2.9 Å

PDB Description: Crystal Structure of the Acyl-CoA Carboxylase, AccD5, from Mycobacterium tuberculosis

PDB Compounds: (D:) Probable propionyl-CoA carboxylase beta chain 5

SCOP Domain Sequences for d2a7sd1:

Sequence; same for both SEQRES and ATOM records:

>d2a7sd1 c.14.1.4 (D:20-277) Propionyl-CoA carboxylase complex B subunit, PccB {Mycobacterium tuberculosis [TaxId: 1773]}
idihttagklaelhkrreeslhpvgedavekvhakgkltareriyalldedsfveldala
khrstnfnlgekrplgdgvvtgygtidgrdvcifsqdatvfggslgevygekivkvqela
iktgrpligindgagariqegvvslglysrifrnnilasgvipqislimgaaagghvysp
altdfvimvdqtsqmfitgpdviktvtgeevtmeelggahthmaksgtahyaasgeqdaf
dyvrellsylppnnstda

Timeline for d2a7sd1:

• d2a7sd1 is new in SCOP 1.73
  
• d2a7sd1 appears in SCOP 1.75
  
• d2a7sd1 appears in the current release, SCOPe 2.08