PDB entry 2a7s

View 2a7s on RCSB PDB site
Description: Crystal Structure of the Acyl-CoA Carboxylase, AccD5, from Mycobacterium tuberculosis
Class: Ligase
Keywords: carboxylase, carboxyltransferase, acetyl-CoA carboxylase, propionyl-CoA carboxylase, Acyl-CoA Carboxylase, mycolic acid, fatty acid, polyketide
Deposited on 2005-07-06, released 2006-02-21
The last revision prior to the SCOP 1.73 freeze date was dated 2006-04-04, with a file datestamp of 2007-07-20.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.193
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable propionyl-CoA carboxylase beta chain 5
    Species: Mycobacterium tuberculosis
    Gene: accD5, pccB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2a7sa1, d2a7sa2
  • Chain 'B':
    Compound: Probable propionyl-CoA carboxylase beta chain 5
    Species: Mycobacterium tuberculosis
    Gene: accD5, pccB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2a7sb1, d2a7sb2
  • Chain 'C':
    Compound: Probable propionyl-CoA carboxylase beta chain 5
    Species: Mycobacterium tuberculosis
    Gene: accD5, pccB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2a7sc1, d2a7sc2
  • Chain 'D':
    Compound: Probable propionyl-CoA carboxylase beta chain 5
    Species: Mycobacterium tuberculosis
    Gene: accD5, pccB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2a7sd1, d2a7sd2
  • Chain 'E':
    Compound: Probable propionyl-CoA carboxylase beta chain 5
    Species: Mycobacterium tuberculosis
    Gene: accD5, pccB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2a7se1, d2a7se2
  • Chain 'F':
    Compound: Probable propionyl-CoA carboxylase beta chain 5
    Species: Mycobacterium tuberculosis
    Gene: accD5, pccB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2a7sf1, d2a7sf2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2a7sA (A:)
    mtsvtdrsahsaerstehtidihttagklaelhkrreeslhpvgedavekvhakgkltar
    eriyalldedsfveldalakhrstnfnlgekrplgdgvvtgygtidgrdvcifsqdatvf
    ggslgevygekivkvqelaiktgrpligindgagariqegvvslglysrifrnnilasgv
    ipqislimgaaagghvyspaltdfvimvdqtsqmfitgpdviktvtgeevtmeelggaht
    hmaksgtahyaasgeqdafdyvrellsylppnnstdapryqaaaptgpieenltdedlel
    dtlipdspnqpydmhevitrllddefleiqagyaqnivvgfgridgrpvgivanqpthfa
    gcldinasekaarfvrtcdcfnipivmlvdvpgflpgtdqeyngiirrgakllyaygeat
    vpkitvitrkayggaycvmgskdmgcdvnlawptaqiavmgasgavgfvyrqqlaeaaan
    gedidklrlrlqqeyedtlvnpyvaaergyvdavippshtrgyigtalrllerkiaqlpp
    kkhgnvpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a7sA (A:)
    idihttagklaelhkrreeslhpvgedavekvhakgkltareriyalldedsfveldala
    khrstnfnlgekrplgdgvvtgygtidgrdvcifsqdatvfggslgevygekivkvqela
    iktgrpligindgagariqegvvslglysrifrnnilasgvipqislimgaaagghvysp
    altdfvimvdqtsqmfitgpdviktvtgeevtmeelggahthmaksgtahyaasgeqdaf
    dyvrellsylppnnstdapryqaaaptgpieenltdedleldtlipdspnqpydmhevit
    rllddefleiqagyaqnivvgfgridgrpvgivanqpthfagcldinasekaarfvrtcd
    cfnipivmlvdvpgflpgtdqeyngiirrgakllyaygeatvpkitvitrkayggaycvm
    gskdmgcdvnlawptaqiavmgasgavgfvyrqqlaeaaangedidklrlrlqqeyedtl
    vnpyvaaergyvdavippshtrgyigtalrllerkiaqlppkkhgnvpl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2a7sB (B:)
    mtsvtdrsahsaerstehtidihttagklaelhkrreeslhpvgedavekvhakgkltar
    eriyalldedsfveldalakhrstnfnlgekrplgdgvvtgygtidgrdvcifsqdatvf
    ggslgevygekivkvqelaiktgrpligindgagariqegvvslglysrifrnnilasgv
    ipqislimgaaagghvyspaltdfvimvdqtsqmfitgpdviktvtgeevtmeelggaht
    hmaksgtahyaasgeqdafdyvrellsylppnnstdapryqaaaptgpieenltdedlel
    dtlipdspnqpydmhevitrllddefleiqagyaqnivvgfgridgrpvgivanqpthfa
    gcldinasekaarfvrtcdcfnipivmlvdvpgflpgtdqeyngiirrgakllyaygeat
    vpkitvitrkayggaycvmgskdmgcdvnlawptaqiavmgasgavgfvyrqqlaeaaan
    gedidklrlrlqqeyedtlvnpyvaaergyvdavippshtrgyigtalrllerkiaqlpp
    kkhgnvpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a7sB (B:)
    idihttagklaelhkrreeslhpvgedavekvhakgkltareriyalldedsfveldala
    khrstnfnlgekrplgdgvvtgygtidgrdvcifsqdatvfggslgevygekivkvqela
    iktgrpligindgagariqegvvslglysrifrnnilasgvipqislimgaaagghvysp
    altdfvimvdqtsqmfitgpdviktvtgeevtmeelggahthmaksgtahyaasgeqdaf
    dyvrellsylppnnstdapryqaaaptgpieenltdedleldtlipdspnqpydmhevit
    rllddefleiqagyaqnivvgfgridgrpvgivanqpthfagcldinasekaarfvrtcd
    cfnipivmlvdvpgflpgtdqeyngiirrgakllyaygeatvpkitvitrkayggaycvm
    gskdmgcdvnlawptaqiavmgasgavgfvyrqqlaeaaangedidklrlrlqqeyedtl
    vnpyvaaergyvdavippshtrgyigtalrllerkiaqlppkkhgnvpl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2a7sC (C:)
    mtsvtdrsahsaerstehtidihttagklaelhkrreeslhpvgedavekvhakgkltar
    eriyalldedsfveldalakhrstnfnlgekrplgdgvvtgygtidgrdvcifsqdatvf
    ggslgevygekivkvqelaiktgrpligindgagariqegvvslglysrifrnnilasgv
    ipqislimgaaagghvyspaltdfvimvdqtsqmfitgpdviktvtgeevtmeelggaht
    hmaksgtahyaasgeqdafdyvrellsylppnnstdapryqaaaptgpieenltdedlel
    dtlipdspnqpydmhevitrllddefleiqagyaqnivvgfgridgrpvgivanqpthfa
    gcldinasekaarfvrtcdcfnipivmlvdvpgflpgtdqeyngiirrgakllyaygeat
    vpkitvitrkayggaycvmgskdmgcdvnlawptaqiavmgasgavgfvyrqqlaeaaan
    gedidklrlrlqqeyedtlvnpyvaaergyvdavippshtrgyigtalrllerkiaqlpp
    kkhgnvpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a7sC (C:)
    idihttagklaelhkrreeslhpvgedavekvhakgkltareriyalldedsfveldala
    khrstnfnlgekrplgdgvvtgygtidgrdvcifsqdatvfggslgevygekivkvqela
    iktgrpligindgagariqegvvslglysrifrnnilasgvipqislimgaaagghvysp
    altdfvimvdqtsqmfitgpdviktvtgeevtmeelggahthmaksgtahyaasgeqdaf
    dyvrellsylppnnstdapryqaaaptgpieenltdedleldtlipdspnqpydmhevit
    rllddefleiqagyaqnivvgfgridgrpvgivanqpthfagcldinasekaarfvrtcd
    cfnipivmlvdvpgflpgtdqeyngiirrgakllyaygeatvpkitvitrkayggaycvm
    gskdmgcdvnlawptaqiavmgasgavgfvyrqqlaeaaangedidklrlrlqqeyedtl
    vnpyvaaergyvdavippshtrgyigtalrllerkiaqlppkkhgnvpl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2a7sD (D:)
    mtsvtdrsahsaerstehtidihttagklaelhkrreeslhpvgedavekvhakgkltar
    eriyalldedsfveldalakhrstnfnlgekrplgdgvvtgygtidgrdvcifsqdatvf
    ggslgevygekivkvqelaiktgrpligindgagariqegvvslglysrifrnnilasgv
    ipqislimgaaagghvyspaltdfvimvdqtsqmfitgpdviktvtgeevtmeelggaht
    hmaksgtahyaasgeqdafdyvrellsylppnnstdapryqaaaptgpieenltdedlel
    dtlipdspnqpydmhevitrllddefleiqagyaqnivvgfgridgrpvgivanqpthfa
    gcldinasekaarfvrtcdcfnipivmlvdvpgflpgtdqeyngiirrgakllyaygeat
    vpkitvitrkayggaycvmgskdmgcdvnlawptaqiavmgasgavgfvyrqqlaeaaan
    gedidklrlrlqqeyedtlvnpyvaaergyvdavippshtrgyigtalrllerkiaqlpp
    kkhgnvpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a7sD (D:)
    idihttagklaelhkrreeslhpvgedavekvhakgkltareriyalldedsfveldala
    khrstnfnlgekrplgdgvvtgygtidgrdvcifsqdatvfggslgevygekivkvqela
    iktgrpligindgagariqegvvslglysrifrnnilasgvipqislimgaaagghvysp
    altdfvimvdqtsqmfitgpdviktvtgeevtmeelggahthmaksgtahyaasgeqdaf
    dyvrellsylppnnstdapryqaaaptgpieenltdedleldtlipdspnqpydmhevit
    rllddefleiqagyaqnivvgfgridgrpvgivanqpthfagcldinasekaarfvrtcd
    cfnipivmlvdvpgflpgtdqeyngiirrgakllyaygeatvpkitvitrkayggaycvm
    gskdmgcdvnlawptaqiavmgasgavgfvyrqqlaeaaangedidklrlrlqqeyedtl
    vnpyvaaergyvdavippshtrgyigtalrllerkiaqlppkkhgnvpl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2a7sE (E:)
    mtsvtdrsahsaerstehtidihttagklaelhkrreeslhpvgedavekvhakgkltar
    eriyalldedsfveldalakhrstnfnlgekrplgdgvvtgygtidgrdvcifsqdatvf
    ggslgevygekivkvqelaiktgrpligindgagariqegvvslglysrifrnnilasgv
    ipqislimgaaagghvyspaltdfvimvdqtsqmfitgpdviktvtgeevtmeelggaht
    hmaksgtahyaasgeqdafdyvrellsylppnnstdapryqaaaptgpieenltdedlel
    dtlipdspnqpydmhevitrllddefleiqagyaqnivvgfgridgrpvgivanqpthfa
    gcldinasekaarfvrtcdcfnipivmlvdvpgflpgtdqeyngiirrgakllyaygeat
    vpkitvitrkayggaycvmgskdmgcdvnlawptaqiavmgasgavgfvyrqqlaeaaan
    gedidklrlrlqqeyedtlvnpyvaaergyvdavippshtrgyigtalrllerkiaqlpp
    kkhgnvpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a7sE (E:)
    idihttagklaelhkrreeslhpvgedavekvhakgkltareriyalldedsfveldala
    khrstnfnlgekrplgdgvvtgygtidgrdvcifsqdatvfggslgevygekivkvqela
    iktgrpligindgagariqegvvslglysrifrnnilasgvipqislimgaaagghvysp
    altdfvimvdqtsqmfitgpdviktvtgeevtmeelggahthmaksgtahyaasgeqdaf
    dyvrellsylppnnstdapryqaaaptgpieenltdedleldtlipdspnqpydmhevit
    rllddefleiqagyaqnivvgfgridgrpvgivanqpthfagcldinasekaarfvrtcd
    cfnipivmlvdvpgflpgtdqeyngiirrgakllyaygeatvpkitvitrkayggaycvm
    gskdmgcdvnlawptaqiavmgasgavgfvyrqqlaeaaangedidklrlrlqqeyedtl
    vnpyvaaergyvdavippshtrgyigtalrllerkiaqlppkkhgnvpl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2a7sF (F:)
    mtsvtdrsahsaerstehtidihttagklaelhkrreeslhpvgedavekvhakgkltar
    eriyalldedsfveldalakhrstnfnlgekrplgdgvvtgygtidgrdvcifsqdatvf
    ggslgevygekivkvqelaiktgrpligindgagariqegvvslglysrifrnnilasgv
    ipqislimgaaagghvyspaltdfvimvdqtsqmfitgpdviktvtgeevtmeelggaht
    hmaksgtahyaasgeqdafdyvrellsylppnnstdapryqaaaptgpieenltdedlel
    dtlipdspnqpydmhevitrllddefleiqagyaqnivvgfgridgrpvgivanqpthfa
    gcldinasekaarfvrtcdcfnipivmlvdvpgflpgtdqeyngiirrgakllyaygeat
    vpkitvitrkayggaycvmgskdmgcdvnlawptaqiavmgasgavgfvyrqqlaeaaan
    gedidklrlrlqqeyedtlvnpyvaaergyvdavippshtrgyigtalrllerkiaqlpp
    kkhgnvpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2a7sF (F:)
    idihttagklaelhkrreeslhpvgedavekvhakgkltareriyalldedsfveldala
    khrstnfnlgekrplgdgvvtgygtidgrdvcifsqdatvfggslgevygekivkvqela
    iktgrpligindgagariqegvvslglysrifrnnilasgvipqislimgaaagghvysp
    altdfvimvdqtsqmfitgpdviktvtgeevtmeelggahthmaksgtahyaasgeqdaf
    dyvrellsylppnnstdapryqaaaptgpieenltdedleldtlipdspnqpydmhevit
    rllddefleiqagyaqnivvgfgridgrpvgivanqpthfagcldinasekaarfvrtcd
    cfnipivmlvdvpgflpgtdqeyngiirrgakllyaygeatvpkitvitrkayggaycvm
    gskdmgcdvnlawptaqiavmgasgavgfvyrqqlaeaaangedidklrlrlqqeyedtl
    vnpyvaaergyvdavippshtrgyigtalrllerkiaqlppkkhgnvpl