Lineage for d2a7sc2 (2a7s C:278-548)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 690605Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 690606Superfamily c.14.1: ClpP/crotonase [52096] (4 families) (S)
  5. 690933Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (6 proteins)
    Pfam PF01039
    the active site is formed by two different homologous subunits or domains of this fold
  6. 691012Protein Propionyl-CoA carboxylase complex B subunit, PccB [117466] (3 species)
  7. 691013Species Mycobacterium tuberculosis [TaxId:1773] [142010] (1 PDB entry)
  8. 691019Domain d2a7sc2: 2a7s C:278-548 [126358]
    automatically matched to 2A7S A:278-548

Details for d2a7sc2

PDB Entry: 2a7s (more details), 2.9 Å

PDB Description: Crystal Structure of the Acyl-CoA Carboxylase, AccD5, from Mycobacterium tuberculosis
PDB Compounds: (C:) Probable propionyl-CoA carboxylase beta chain 5

SCOP Domain Sequences for d2a7sc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a7sc2 c.14.1.4 (C:278-548) Propionyl-CoA carboxylase complex B subunit, PccB {Mycobacterium tuberculosis [TaxId: 1773]}
pryqaaaptgpieenltdedleldtlipdspnqpydmhevitrllddefleiqagyaqni
vvgfgridgrpvgivanqpthfagcldinasekaarfvrtcdcfnipivmlvdvpgflpg
tdqeyngiirrgakllyaygeatvpkitvitrkayggaycvmgskdmgcdvnlawptaqi
avmgasgavgfvyrqqlaeaaangedidklrlrlqqeyedtlvnpyvaaergyvdavipp
shtrgyigtalrllerkiaqlppkkhgnvpl

SCOP Domain Coordinates for d2a7sc2:

Click to download the PDB-style file with coordinates for d2a7sc2.
(The format of our PDB-style files is described here.)

Timeline for d2a7sc2: