Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (4 families) |
Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (6 proteins) Pfam PF01039 the active site is formed by two different homologous subunits or domains of this fold |
Protein Propionyl-CoA carboxylase complex B subunit, PccB [117466] (3 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [142010] (1 PDB entry) |
Domain d2a7sd2: 2a7s D:278-548 [126360] automatically matched to 2A7S A:278-548 |
PDB Entry: 2a7s (more details), 2.9 Å
SCOP Domain Sequences for d2a7sd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a7sd2 c.14.1.4 (D:278-548) Propionyl-CoA carboxylase complex B subunit, PccB {Mycobacterium tuberculosis [TaxId: 1773]} pryqaaaptgpieenltdedleldtlipdspnqpydmhevitrllddefleiqagyaqni vvgfgridgrpvgivanqpthfagcldinasekaarfvrtcdcfnipivmlvdvpgflpg tdqeyngiirrgakllyaygeatvpkitvitrkayggaycvmgskdmgcdvnlawptaqi avmgasgavgfvyrqqlaeaaangedidklrlrlqqeyedtlvnpyvaaergyvdavipp shtrgyigtalrllerkiaqlppkkhgnvpl
Timeline for d2a7sd2: