Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (4 families) contains an additional N-terminal strand |
Family b.1.10.2: gamma-adaptin C-terminal appendage domain-like [74857] (4 proteins) consist of a single subdomain automatically mapped to Pfam PF02883 |
Protein automated matches [190194] (2 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [186937] (1 PDB entry) |
Domain d2a7ba_: 2a7b A: [126333] automated match to d1gyua_ complexed with xe |
PDB Entry: 2a7b (more details), 1.65 Å
SCOPe Domain Sequences for d2a7ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a7ba_ b.1.10.2 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} mipsitaysknglkieftfersntnpsvtvitiqasnsteldmtdfvfqaavpktfqlql lspsssvvpafntgtitqvikvlnpqkqqlrmrikltynhkgsamqdlaevnnfppqswq
Timeline for d2a7ba_: