SCOP 1.73: Domain d2a7ba1: 2a7b A:703-822

Lineage for d2a7ba1 (2a7b A:703-822)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (3 families)
   contains an additional N-terminal strand

5. Family b.1.10.2: gamma-adaptin C-terminal appendage domain-like [74857] (3 proteins)
   consist of a single subdomain

6. Protein Gamma1-adaptin domain [74858] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [74859] (5 PDB entries)

8. Domain d2a7ba1: 2a7b A:703-822 [126333]
   automatically matched to d1gyua_
   complexed with xe

Details for d2a7ba1

PDB Entry: 2a7b, 1.65 Å

PDB Description: On the Routine Use of Soft X-Rays in Macromolecular Crystallography, Part III- The Optimal Data Collection Wavelength

PDB Compounds: (A:) gamma-adaptin appendage domain

SCOP Domain Sequences for d2a7ba1:

Sequence; same for both SEQRES and ATOM records:

>d2a7ba1 b.1.10.2 (A:703-822) Gamma1-adaptin domain {Human (Homo sapiens) [TaxId: 9606]}
mipsitaysknglkieftfersntnpsvtvitiqasnsteldmtdfvfqaavpktfqlql
lspsssvvpafntgtitqvikvlnpqkqqlrmrikltynhkgsamqdlaevnnfppqswq

Timeline for d2a7ba1:

• d2a7ba1 is new in SCOP 1.73
  
• d2a7ba1 appears in SCOP 1.75
  
• d2a7ba1 appears in the current release, SCOPe 2.08, called d2a7ba_