Lineage for d2a7ba_ (2a7b A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2764533Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (4 families) (S)
    contains an additional N-terminal strand
  5. 2764555Family b.1.10.2: gamma-adaptin C-terminal appendage domain-like [74857] (4 proteins)
    consist of a single subdomain
    automatically mapped to Pfam PF02883
  6. 2764573Protein automated matches [190194] (2 species)
    not a true protein
  7. 2764583Species Mouse (Mus musculus) [TaxId:10090] [186937] (1 PDB entry)
  8. 2764584Domain d2a7ba_: 2a7b A: [126333]
    automated match to d1gyua_
    complexed with xe

Details for d2a7ba_

PDB Entry: 2a7b (more details), 1.65 Å

PDB Description: On the Routine Use of Soft X-Rays in Macromolecular Crystallography, Part III- The Optimal Data Collection Wavelength
PDB Compounds: (A:) gamma-adaptin appendage domain

SCOPe Domain Sequences for d2a7ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a7ba_ b.1.10.2 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mipsitaysknglkieftfersntnpsvtvitiqasnsteldmtdfvfqaavpktfqlql
lspsssvvpafntgtitqvikvlnpqkqqlrmrikltynhkgsamqdlaevnnfppqswq

SCOPe Domain Coordinates for d2a7ba_:

Click to download the PDB-style file with coordinates for d2a7ba_.
(The format of our PDB-style files is described here.)

Timeline for d2a7ba_: