Lineage for d2a7ba1 (2a7b A:703-822)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 788679Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (3 families) (S)
    contains an additional N-terminal strand
  5. 788701Family b.1.10.2: gamma-adaptin C-terminal appendage domain-like [74857] (3 proteins)
    consist of a single subdomain
  6. 788719Protein Gamma1-adaptin domain [74858] (1 species)
  7. 788720Species Human (Homo sapiens) [TaxId:9606] [74859] (5 PDB entries)
  8. 788722Domain d2a7ba1: 2a7b A:703-822 [126333]
    automatically matched to d1gyua_
    complexed with xe

Details for d2a7ba1

PDB Entry: 2a7b (more details), 1.65 Å

PDB Description: On the Routine Use of Soft X-Rays in Macromolecular Crystallography, Part III- The Optimal Data Collection Wavelength
PDB Compounds: (A:) gamma-adaptin appendage domain

SCOP Domain Sequences for d2a7ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a7ba1 b.1.10.2 (A:703-822) Gamma1-adaptin domain {Human (Homo sapiens) [TaxId: 9606]}
mipsitaysknglkieftfersntnpsvtvitiqasnsteldmtdfvfqaavpktfqlql
lspsssvvpafntgtitqvikvlnpqkqqlrmrikltynhkgsamqdlaevnnfppqswq

SCOP Domain Coordinates for d2a7ba1:

Click to download the PDB-style file with coordinates for d2a7ba1.
(The format of our PDB-style files is described here.)

Timeline for d2a7ba1: