SCOPe 2.04: Domain d2a7ba_: 2a7b A:

Lineage for d2a7ba_ (2a7b A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (4 families)
   contains an additional N-terminal strand

5. Family b.1.10.2: gamma-adaptin C-terminal appendage domain-like [74857] (4 proteins)
   consist of a single subdomain
   automatically mapped to Pfam PF02883

6. Protein automated matches [190194] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186937] (1 PDB entry)

8. Domain d2a7ba_: 2a7b A: [126333]
   automated match to d1gyua_
   complexed with xe

Details for d2a7ba_

PDB Entry: 2a7b, 1.65 Å

PDB Description: On the Routine Use of Soft X-Rays in Macromolecular Crystallography, Part III- The Optimal Data Collection Wavelength

PDB Compounds: (A:) gamma-adaptin appendage domain

SCOPe Domain Sequences for d2a7ba_:

Sequence; same for both SEQRES and ATOM records:

>d2a7ba_ b.1.10.2 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mipsitaysknglkieftfersntnpsvtvitiqasnsteldmtdfvfqaavpktfqlql
lspsssvvpafntgtitqvikvlnpqkqqlrmrikltynhkgsamqdlaevnnfppqswq

Timeline for d2a7ba_:

• d2a7ba_ first appeared in SCOP 1.73, called d2a7ba1
  
• d2a7ba_ appears in SCOPe 2.03
  
• d2a7ba_ appears in SCOPe 2.05
  
• d2a7ba_ appears in the current release, SCOPe 2.08