Lineage for d2a6hp1 (2a6h P:258-318)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1260796Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (3 families) (S)
  5. 1260797Family a.4.13.1: Sigma3 domain [88660] (3 proteins)
  6. 1260809Protein Sigma70 [88661] (1 species)
  7. 1260810Species Thermus thermophilus [TaxId:274] [88662] (10 PDB entries)
    Uniprot Q9WX78
  8. 1260814Domain d2a6hp1: 2a6h P:258-318 [126277]
    Other proteins in same PDB: d2a6ha1, d2a6ha2, d2a6hb1, d2a6hb2, d2a6hc_, d2a6hd_, d2a6he_, d2a6hf2, d2a6hf3, d2a6hk1, d2a6hk2, d2a6hl1, d2a6hl2, d2a6hm_, d2a6hn_, d2a6ho_, d2a6hp2, d2a6hp3
    automated match to d1smyf1
    protein/RNA complex; complexed with mg, std, zn

Details for d2a6hp1

PDB Entry: 2a6h (more details), 2.4 Å

PDB Description: Crystal structure of the T. thermophilus RNA polymerase holoenzyme in complex with antibiotic sterptolydigin
PDB Compounds: (P:) RNA polymerase sigma factor rpoD

SCOPe Domain Sequences for d2a6hp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a6hp1 a.4.13.1 (P:258-318) Sigma70 {Thermus thermophilus [TaxId: 274]}
iripvhmvetinklsrtarqlqqelgreptyeeiaeamgpgwdakrveetlkiaqepvsl
e

SCOPe Domain Coordinates for d2a6hp1:

Click to download the PDB-style file with coordinates for d2a6hp1.
(The format of our PDB-style files is described here.)

Timeline for d2a6hp1: