| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily) core: 2 helices and adjacent loops |
Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) ![]() the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits |
| Family a.143.1.1: RNA polymerase omega subunit [63563] (2 proteins) 4 helices; irregular array |
| Protein automated matches [190193] (2 species) not a true protein |
| Species Thermus thermophilus [TaxId:274] [186933] (6 PDB entries) |
| Domain d2a6ho_: 2a6h O: [126276] Other proteins in same PDB: d2a6ha1, d2a6ha2, d2a6hb1, d2a6hb2, d2a6hc_, d2a6hd_, d2a6hf1, d2a6hf2, d2a6hf3, d2a6hk1, d2a6hk2, d2a6hl1, d2a6hl2, d2a6hm_, d2a6hn_, d2a6hp1, d2a6hp2, d2a6hp3 automated match to d1iw7e_ protein/RNA complex; complexed with mg, std, zn |
PDB Entry: 2a6h (more details), 2.4 Å
SCOPe Domain Sequences for d2a6ho_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a6ho_ a.143.1.1 (O:) automated matches {Thermus thermophilus [TaxId: 274]}
aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnae
twamkelltgrlvfgenlvpedrlqkemeriypge
Timeline for d2a6ho_: