Lineage for d2a6ha1 (2a6h A:1-49,A:173-229)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1420028Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 1420151Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families) (S)
    form homo and heterodimers
  5. 1420152Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins)
  6. 1420153Protein RNA polymerase alpha [55259] (3 species)
  7. 1420168Species Thermus thermophilus [TaxId:274] [75478] (13 PDB entries)
    Uniprot Q9Z9H6; part of multichain biological unit
  8. 1420181Domain d2a6ha1: 2a6h A:1-49,A:173-229 [126260]
    Other proteins in same PDB: d2a6ha2, d2a6hb2, d2a6hc_, d2a6hd_, d2a6he_, d2a6hf1, d2a6hf2, d2a6hf3, d2a6hk2, d2a6hl2, d2a6hm_, d2a6hn_, d2a6ho_, d2a6hp1, d2a6hp2, d2a6hp3
    automated match to d1smya1
    protein/RNA complex; complexed with mg, std, zn

Details for d2a6ha1

PDB Entry: 2a6h (more details), 2.4 Å

PDB Description: Crystal structure of the T. thermophilus RNA polymerase holoenzyme in complex with antibiotic sterptolydigin
PDB Compounds: (A:) DNA-directed RNA polymerase alpha chain

SCOPe Domain Sequences for d2a6ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a6ha1 d.74.3.1 (A:1-49,A:173-229) RNA polymerase alpha {Thermus thermophilus [TaxId: 274]}
mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipXpvrrvafqve
dtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpq

SCOPe Domain Coordinates for d2a6ha1:

Click to download the PDB-style file with coordinates for d2a6ha1.
(The format of our PDB-style files is described here.)

Timeline for d2a6ha1: