Lineage for d1smyf1 (1smy F:258-318)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1260796Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (3 families) (S)
  5. 1260797Family a.4.13.1: Sigma3 domain [88660] (3 proteins)
  6. 1260809Protein Sigma70 [88661] (1 species)
  7. 1260810Species Thermus thermophilus [TaxId:274] [88662] (10 PDB entries)
    Uniprot Q9WX78
  8. 1260811Domain d1smyf1: 1smy F:258-318 [105781]
    Other proteins in same PDB: d1smya1, d1smya2, d1smyb1, d1smyb2, d1smyc_, d1smyd_, d1smye_, d1smyf2, d1smyf3, d1smyk1, d1smyk2, d1smyl1, d1smyl2, d1smym_, d1smyn_, d1smyo_, d1smyp2, d1smyp3
    complexed with g4p, mg, zn

Details for d1smyf1

PDB Entry: 1smy (more details), 2.7 Å

PDB Description: Structural basis for transcription regulation by alarmone ppGpp
PDB Compounds: (F:) principal sigma factor

SCOPe Domain Sequences for d1smyf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1smyf1 a.4.13.1 (F:258-318) Sigma70 {Thermus thermophilus [TaxId: 274]}
iripvhmvetinklsrtarqlqqelgreptyeeiaeamgpgwdakrveetlkiaqepvsl
e

SCOPe Domain Coordinates for d1smyf1:

Click to download the PDB-style file with coordinates for d1smyf1.
(The format of our PDB-style files is described here.)

Timeline for d1smyf1: