Lineage for d1smyo_ (1smy O:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1284114Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
    core: 2 helices and adjacent loops
  4. 1284115Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) (S)
    the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits
  5. 1284116Family a.143.1.1: RNA polymerase omega subunit [63563] (2 proteins)
    4 helices; irregular array
  6. 1284117Protein RNA polymerase omega subunit [63564] (3 species)
  7. 1284125Species Thermus thermophilus [TaxId:274] [74729] (4 PDB entries)
    Uniprot Q8RQE7; part of multichain biological unit
  8. 1284127Domain d1smyo_: 1smy O: [105790]
    Other proteins in same PDB: d1smya1, d1smya2, d1smyb1, d1smyb2, d1smyc_, d1smyd_, d1smyf1, d1smyf2, d1smyf3, d1smyk1, d1smyk2, d1smyl1, d1smyl2, d1smym_, d1smyn_, d1smyp1, d1smyp2, d1smyp3
    complexed with g4p, mg, zn

Details for d1smyo_

PDB Entry: 1smy (more details), 2.7 Å

PDB Description: Structural basis for transcription regulation by alarmone ppGpp
PDB Compounds: (O:) RNA polymerase omega subunit

SCOPe Domain Sequences for d1smyo_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1smyo_ a.143.1.1 (O:) RNA polymerase omega subunit {Thermus thermophilus [TaxId: 274]}
aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnae
twamkelltgrlvfgenlvpedrlqkemeriypge

SCOPe Domain Coordinates for d1smyo_:

Click to download the PDB-style file with coordinates for d1smyo_.
(The format of our PDB-style files is described here.)

Timeline for d1smyo_: