Lineage for d2a6ef1 (2a6e F:258-318)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1260796Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (3 families) (S)
  5. 1260797Family a.4.13.1: Sigma3 domain [88660] (3 proteins)
  6. 1260809Protein Sigma70 [88661] (1 species)
  7. 1260810Species Thermus thermophilus [TaxId:274] [88662] (10 PDB entries)
    Uniprot Q9WX78
  8. 1260825Domain d2a6ef1: 2a6e F:258-318 [126247]
    Other proteins in same PDB: d2a6ea1, d2a6ea2, d2a6eb1, d2a6eb2, d2a6ec_, d2a6ed_, d2a6ee_, d2a6ef2, d2a6ef3, d2a6ek1, d2a6ek2, d2a6el1, d2a6el2, d2a6em_, d2a6en_, d2a6eo_, d2a6ep2, d2a6ep3
    automated match to d1smyf1
    complexed with mg, zn

Details for d2a6ef1

PDB Entry: 2a6e (more details), 2.8 Å

PDB Description: Crystal structure of the T. Thermophilus RNA polymerase holoenzyme
PDB Compounds: (F:) RNA polymerase sigma factor rpoD

SCOPe Domain Sequences for d2a6ef1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a6ef1 a.4.13.1 (F:258-318) Sigma70 {Thermus thermophilus [TaxId: 274]}
iripvhmvetinklsrtarqlqqelgreptyeeiaeamgpgwdakrveetlkiaqepvsl
e

SCOPe Domain Coordinates for d2a6ef1:

Click to download the PDB-style file with coordinates for d2a6ef1.
(The format of our PDB-style files is described here.)

Timeline for d2a6ef1: