Lineage for d2a6eo_ (2a6e O:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1284114Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
    core: 2 helices and adjacent loops
  4. 1284115Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) (S)
    the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits
  5. 1284116Family a.143.1.1: RNA polymerase omega subunit [63563] (2 proteins)
    4 helices; irregular array
  6. 1284134Protein automated matches [190193] (2 species)
    not a true protein
  7. 1284135Species Thermus thermophilus [TaxId:274] [186933] (6 PDB entries)
  8. 1284147Domain d2a6eo_: 2a6e O: [126256]
    Other proteins in same PDB: d2a6ea1, d2a6ea2, d2a6eb1, d2a6eb2, d2a6ec_, d2a6ed_, d2a6ef1, d2a6ef2, d2a6ef3, d2a6ek1, d2a6ek2, d2a6el1, d2a6el2, d2a6em_, d2a6en_, d2a6ep1, d2a6ep2, d2a6ep3
    automated match to d1iw7e_
    complexed with mg, zn

Details for d2a6eo_

PDB Entry: 2a6e (more details), 2.8 Å

PDB Description: Crystal structure of the T. Thermophilus RNA polymerase holoenzyme
PDB Compounds: (O:) RNA polymerase omega chain

SCOPe Domain Sequences for d2a6eo_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a6eo_ a.143.1.1 (O:) automated matches {Thermus thermophilus [TaxId: 274]}
aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnae
twamkelltgrlvfgenlvpedrlqkemeriypge

SCOPe Domain Coordinates for d2a6eo_:

Click to download the PDB-style file with coordinates for d2a6eo_.
(The format of our PDB-style files is described here.)

Timeline for d2a6eo_: