Lineage for d2a6ef3 (2a6e F:74-257)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1285121Fold a.177: Sigma2 domain of RNA polymerase sigma factors [88945] (1 superfamily)
    multihelical; consists of a conserved 4-helical core and a variable insert subdomain
  4. 1285122Superfamily a.177.1: Sigma2 domain of RNA polymerase sigma factors [88946] (1 family) (S)
  5. 1285123Family a.177.1.1: Sigma2 domain of RNA polymerase sigma factors [88947] (5 proteins)
  6. 1285139Protein Sigma70 [88948] (2 species)
  7. 1285142Species Thermus thermophilus [TaxId:274] [88949] (10 PDB entries)
    Uniprot Q9WX78
  8. 1285157Domain d2a6ef3: 2a6e F:74-257 [126249]
    Other proteins in same PDB: d2a6ea1, d2a6ea2, d2a6eb1, d2a6eb2, d2a6ec_, d2a6ed_, d2a6ee_, d2a6ef1, d2a6ef2, d2a6ek1, d2a6ek2, d2a6el1, d2a6el2, d2a6em_, d2a6en_, d2a6eo_, d2a6ep1, d2a6ep2
    automated match to d1smyf3
    complexed with mg, zn

Details for d2a6ef3

PDB Entry: 2a6e (more details), 2.8 Å

PDB Description: Crystal structure of the T. Thermophilus RNA polymerase holoenzyme
PDB Compounds: (F:) RNA polymerase sigma factor rpoD

SCOPe Domain Sequences for d2a6ef3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a6ef3 a.177.1.1 (F:74-257) Sigma70 {Thermus thermophilus [TaxId: 274]}
kistsdpvrqylheigqvplltleeevelarkveegmeaikklseitgldpdlirevvra
kilgsarvrhipglketldpktveeidqklkslpkehkrylhiaregeaarqhlieanlr
lvvsiakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraiad
qart

SCOPe Domain Coordinates for d2a6ef3:

Click to download the PDB-style file with coordinates for d2a6ef3.
(The format of our PDB-style files is described here.)

Timeline for d2a6ef3: